PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00002002-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family FAR1
Protein Properties Length: 555aa    MW: 62269.3 Da    PI: 6.0548
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00002002-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR174.42.4e-23188274190
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            k+Yn+YA + GFs+rk+  +ksk +g +++r+++C ++g+ +++++    + ++r+etrtgC+a+++++++++gk++v+++e+ HnHe
  SMil_00002002-RA_Salv 188 KCYNRYALMEGFSIRKDFVNKSKVTGLVVSRRYTCHRQGYGSSKRDM---NMKPRKETRTGCQAHMTITRQTNGKYRVIHFETRHNHE 272
                            58***************************************998776...999*********************************** PP

                   FAR1  89 la 90 
                            ++
  SMil_00002002-RA_Salv 273 FV 274
                            97 PP

2FAR189.35.5e-28322411191
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            +fYn+YA ++GFs+rk++ ++sk +g + +r+++C +eg+r+++k+  +k +r+r+etr+gC a+l+++++ dg+++vt++e+ HnHe
  SMil_00002002-RA_Salv 322 EFYNAYAGRLGFSIRKDYVNRSKVDGAVASRRYTCFREGYRQNDKRG-SKVKRPRKETRVGCMAQLVISRQADGRYRVTHFEERHNHE 408
                            6*******************************************999.99************************************** PP

                   FAR1  89 lap 91 
                            l+p
  SMil_00002002-RA_Salv 409 LVP 411
                            *86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.9E-21189274IPR004330FAR1 DNA binding domain
PfamPF031015.4E-25322411IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MDSGLGSGAR DSSEDDIVGV GDPTAVVDAC INQIGEVSSF LYDDEEVFVH EDASLSREAS  60
STEKDGMDVD RESTYSCLNS SSSEEKSFDS DGKHESASQN GCLNNDAECK SPKACISGNN  120
GPDILGEQDD RSPGISSDDQ LGMDADDKQV SIAETPSNAS SGSIKDEAEE YIVPELGVEF  180
ESEEHAYKCY NRYALMEGFS IRKDFVNKSK VTGLVVSRRY TCHRQGYGSS KRDMNMKPRK  240
ETRTGCQAHM TITRQTNGKY RVIHFETRHN HEFVTPFTAH LLPSQKRISF VEAVEAESAA  300
APVPDGVPKL GMGFDSEDHA YEFYNAYAGR LGFSIRKDYV NRSKVDGAVA SRRYTCFREG  360
YRQNDKRGSK VKRPRKETRV GCMAQLVISR QADGRYRVTH FEERHNHELV PACKVRTLRS  420
QRRSLTNQIV ESSASGASDM PPKSVAELLL AGAGVMLDAY SLWENEWLRG VFEEREKWAL  480
PYSKHIFSAD IETAFLSECS ITSLKKYVKH ESHILQFVKH FGRVVNDWRY KELEANYDMG  540
QHVPRLMGDV IMLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098802.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_011098803.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_011098804.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_011098805.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2
TrEMBLA0A061EK261e-146A0A061EK26_THECC; Far1-related sequence 5, putative isoform 1
STRINGGLYMA05G06351.11e-133(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30211740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06250.14e-28FAR1-related sequence 7